PDB entry 1j85

View 1j85 on RCSB PDB site
Description: Structure of YibK from Haemophilus influenzae (HI0766), a truncated sequence homolog of tRNA (guanosine-2'-O-) methyltransferase (SpoU)
Class: transferase
Keywords: methyltransferase, structural genomics, hypothetical protein, Structure 2 Function Project, S2F, TRANSFERASE
Deposited on 2001-05-20, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YibK
    Species: Haemophilus influenzae Rd [TaxId:71421]
    Gene: HI0766
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j85a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j85A (A:)
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnlpevk

    Sequence, based on observed residues (ATOM records): (download) 
    >1j85A (A:)
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnl