PDB entry 1j7e

View 1j7e on RCSB PDB site
Description: A Structural Basis for the Unique Binding Features of the Human Vitamin D-binding Protein
Class: transport, ligand binding protein
Keywords: vitamin D binding, vitamin D3 analogue, Group-specific component, Gc-globulin, TRANSPORT, LIGAND BINDING PROTEIN
Deposited on 2001-05-16, released 2002-02-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vitamin D binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02774
      • variant (419)
    Domains in SCOPe 2.04: d1j7ea1, d1j7ea2, d1j7ea3
  • Chain 'B':
    Compound: vitamin D binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02774
      • variant (419)
    Domains in SCOPe 2.04: d1j7eb1, d1j7eb2, d1j7eb3
  • Heterogens: JY, OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7eA (A:)
    lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
    egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
    veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
    vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
    ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
    aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
    dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpt
    elaklvnkrsdfasnccsinspplycdseidaelknil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7eA (A:)
    yeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccdtrtsal
    sakscspfpvhpgtaecctkrklcmaalkhqpqefptyveptndeiceafrkdpkeyanq
    fmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlqlkhlsllttlsnr
    vcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcmakel
    pehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdvcdpg
    ntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkkelss
    fidkgqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinsp
    plycdseidaelkni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j7eB (B:)
    lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
    egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
    veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
    vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
    ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
    aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
    dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpt
    elaklvnkrsdfasnccsinspplycdseidaelknil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7eB (B:)
    rgrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaeg
    adpdcydtrtsalsakscesnspfpvhpgtaecctlcmaalkhqpqefptyveptndeic
    eafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlq
    lkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskc
    cesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpd
    velptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcf
    nakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatptelaklvnkr
    sdfasnccsinspplycdseidaelkn