PDB entry 1j47

View 1j47 on RCSB PDB site
Description: 3D Solution NMR Structure of the M9I Mutant of the HMG-Box Domain of the Human Male Sex Determining Factor SRY Complexed to DNA
Class: transcription/DNA
Keywords: male sex determining factor, sry, sex-reversal mutation, DNA bending mutant, dipolar couplings, multidimensional nmr, transcription/DNA complex
Deposited on 2001-07-23, released 2001-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: 0.2
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex-determining region y protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05066 (1-84)
      • cloning artifact (0)
      • engineered (8)
    Domains in SCOPe 2.07: d1j47a1, d1j47a2
  • Chain 'B':
    Compound: 5'-d(*cp*cp*tp*gp*cp*ap*cp*ap*ap*ap*cp*ap*cp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*gp*tp*gp*tp*tp*tp*gp*tp*gp*cp*ap*gp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j47A (A:)
    mqdrvkrpinafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqk
    lqamhrekypnykyrprrkakmlpk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.