PDB entry 1j2n

View 1j2n on RCSB PDB site
Description: Solution structure of CPI-17(22-120) T38D
Class: protein binding
Keywords: Helix bundle, PROTEIN BINDING
Deposited on 2003-01-07, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-kDa PKC-potentiated inhibitory protein of PP1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O18734 (0-98)
      • engineered (16)
    Domains in SCOPe 2.07: d1j2na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2nA (A:)
    gpggspgglqkrharvdvkydrrelqrrldvekwidgrleelyrgreadmpdevnidell
    eleseeersrkiqgllksctnptenfvqellvklrglhk