PDB entry 1izb

View 1izb on RCSB PDB site
Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
Class: hormone
Keywords: hormone
Deposited on 1992-10-16, released 1993-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.02: d1izb.1
• Chain 'B':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-28)
    • engineered mutation (12)
  Domains in SCOPe 2.02: d1izb.1
• Chain 'C':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.02: d1izb.2
• Chain 'D':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-28)
    • engineered mutation (12)
  Domains in SCOPe 2.02: d1izb.2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izbA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izbB (B:)
  fvnqhlcgshlvqalylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izbC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1izbD (D:)
  fvnqhlcgshlvqalylvcgergffytpkt