PDB entry 1iym

View 1iym on RCSB PDB site
Description: RING-H2 finger domain of EL5
Class: DNA binding protein
Keywords: RING-H2 finger, ubiquitin ligase, DNA binding protein
Deposited on 2002-08-30, released 2003-07-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: el5
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LRB7 (2-54)
      • cloning artifact (0-1)
    Domains in SCOPe 2.04: d1iyma_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iymA (A:)
    amddgvecavclaeledgeearflprcghgfhaecvdmwlgshstcplcrltvvv