PDB entry 1iwd

View 1iwd on RCSB PDB site
Description: Proposed Amino Acid Sequence and the 1.63 Angstrom X-ray Crystal Structure of a Plant Cysteine Protease Ervatamin B: Insight into the Structural Basis of its Stability and Substrate Specificity.
Class: hydrolase
Keywords: Cysteine protease, alpha-beta protein, catalytic dyad, L-domain, R-domain., HYDROLASE
Deposited on 2002-05-02, released 2003-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.161
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ervatamin b
  Species: Tabernaemontana divaricata [TaxId:52861]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60994 (0-214)
  Domains in SCOPe 2.07: d1iwda_
• Heterogens: THJ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iwdA (A:)
  lpsfvdwrskgavnsiknqkqcgscwafsavaavesinkirtgqlislseqelvdcdtas
  hgcnggwmnnafqyiitnggidtqqnypysavqgsckpyrlrvvsingfqrvtrnnesal
  qsavasqpvsvtveaagapfqhyssgiftgpcgtaqnhgvvivgygtqsgknywivrnsw
  gqnwgnqgyiwmernvassaglcgiaqlpsyptka