PDB entry 1iu0

View 1iu0 on RCSB PDB site
Description: The first PDZ domain of PSD-95
Class: neuropeptide
Keywords: PSD-95, PDZ domain, post synaptic density, NEUROPEPTIDE
Deposited on 2002-02-18, released 2003-03-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: psd-95
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31016 (0-90)
  Domains in SCOPe 2.04: d1iu0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iu0A (A:)
  meyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfv
  nevdvrevthsaavealkeagsivrlyvmrr