PDB entry 1irz

View 1irz on RCSB PDB site
Description: Solution structure of ARR10-B belonging to the GARP family of plant Myb-related DNA binding motifs of the Arabidopsis response regulators
Class: DNA binding protein
Keywords: Helix-turn-Helix, DNA BINDING PROTEIN
Deposited on 2001-10-25, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arr10-b
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O49397 (0-63)
  Domains in SCOPe 2.07: d1irza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1irzA (A:)
  taqkkprvlwthelhnkflaavdhlgveravpkkildlmnvdkltrenvashlqkfrval
  kkvs