PDB entry 1iqu

View 1iqu on RCSB PDB site
Description: Crystal structure of photolyase-thymine complex
Class: lyase
Keywords: DNA repair, Cyclobutane pyrimidine dimer (CPD), FAD, Photoreactivating Enzyme, DNA-binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2001-08-03, released 2002-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photolyase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iqua1, d1iqua2
  • Heterogens: PO4, TDR, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iquA (A:)
    mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralrea
    yrarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllp
    aphllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgee
    aalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegark
    wvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamr
    elhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvd
    aapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iquA (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlard