PDB entry 1iqt

View 1iqt on RCSB PDB site
Description: Solution structure of the C-terminal RNA-binding domain of heterogeneous nuclear ribonucleoprotein D0 (AUF1)
Class: RNA binding protein
Keywords: RNA-binding protein, hnRNP, AUF1, telomere, DNA-binding protein, RNA BINDING PROTEIN
Deposited on 2001-08-01, released 2002-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heterogeneous nuclear ribonucleoprotein D0
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14103 (0-74)
  Domains in SCOPe 2.08: d1iqta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iqtA (A:)
  kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
  kyhnvglskceikva