Lineage for d1iqta_ (1iqt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952019Protein Nuclear ribonucleoprotein D0 (AUF1) [75439] (1 species)
  7. 2952020Species Human (Homo sapiens) [TaxId:9606] [75440] (1 PDB entry)
  8. 2952021Domain d1iqta_: 1iqt A: [71279]
    domain 1

Details for d1iqta_

PDB Entry: 1iqt (more details)

PDB Description: solution structure of the c-terminal rna-binding domain of heterogeneous nuclear ribonucleoprotein d0 (auf1)
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d1iqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqta_ d.58.7.1 (A:) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}
kifvgglspdtpeekireyfggfgevesielpmdnktnkrrgfcfitfkeeepvkkimek
kyhnvglskceikva

SCOPe Domain Coordinates for d1iqta_:

Click to download the PDB-style file with coordinates for d1iqta_.
(The format of our PDB-style files is described here.)

Timeline for d1iqta_: