PDB entry 1iqr

View 1iqr on RCSB PDB site
Description: Crystal structure of DNA photolyase from Thermus thermophilus
Class: lyase
Keywords: DNA repair, Cyclobutane pyrimidine dimer (CPD), FAD, Photoreactivating Enzyme, DNA-binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2001-07-27, released 2001-11-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photolyase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iqra1, d1iqra2
  • Heterogens: PO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iqrA (A:)
    mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralrea
    yrarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllp
    aphllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgee
    aalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegark
    wvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamr
    elhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvd
    aapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqrA (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlard