PDB entry 1ipi

View 1ipi on RCSB PDB site
Description: crystal structure of the archaeal holliday junction resolvase hjc from pyrococcus furiosus form ii
Deposited on 2001-05-15, released 2001-11-28
The last revision prior to the SCOP 1.63 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ipia_
  • Chain 'B':
    Domains in SCOP 1.63: d1ipib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ipiA (A:)
    myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
    dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ipiB (B:)
    myrkgaqaerelikllekhgfavvrsagskkvdlvagngkkylcievkvtkkdhlyvgkr
    dmgrliefsrrfggipvlavkflnvgwrfievspkiekfvftpssgvslevllg