PDB entry 1ilf

View 1ilf on RCSB PDB site
Description: nmr structure of apo cbfb
Class: transcription
Keywords: partially open beta barrel, TRANSCRIPTION
Deposited on 2001-05-08, released 2001-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: core-binding factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ilfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilfA (A:)
    mprvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvat
    gtnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrld
    gmgclefdeeraqqedalaqq