PDB entry 1il6

View 1il6 on RCSB PDB site
Description: human interleukin-6, nmr, minimized average structure
Class: cytokine
Keywords: cytokine, glycoprotein, growth factor
Deposited on 1997-01-31, released 1998-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1il6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1il6A (A:)
    apvppgedskdvaaphrqpltsseridkqiryildgisalrketcnksnmcesskealae
    nnlnlpkmaekdgcfqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmst
    kvliqflqkkaknldaittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslr
    alrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1il6A (A:)
    ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
    neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
    pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm