SCOPe 2.08: Domain d1il6a_: 1il6 A:

Lineage for d1il6a_ (1il6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)

8. Domain d1il6a_: 1il6 A: [16827]

Details for d1il6a_

PDB Entry: 1il6

PDB Description: human interleukin-6, nmr, minimized average structure

PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d1il6a_:

Sequence; same for both SEQRES and ATOM records:

>d1il6a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d1il6a_:

• d1il6a_ first appeared (with stable ids) in SCOP 1.55, called d1il6__
  
• d1il6a_ appears in SCOPe 2.07