PDB entry 1ikm

View 1ikm on RCSB PDB site
Description: nmr study of monomeric human interleukin-8 (30 structures)
Deposited on 1995-08-03, released 1995-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1ikm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ikm_ (-)
  elrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvve
  kflkraens