PDB entry 1iiz

View 1iiz on RCSB PDB site
Description: Crystal Structure of the Induced Antibacterial Protein from Tasar Silkworm, Antheraea mylitta
Deposited on 2001-04-24, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1iiza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iizA (A:)
    krftrcglvnelrkqgfdenlmrdwvclvenesarytdkianvnkngsrdyglfqindky
    wcskgstpgkdcnvtcsqlltdditvastcakkiykrtkfdawsgwdnhcnhsnpdissc