PDB entry 1iiu

View 1iiu on RCSB PDB site
Description: Chicken plasma retinol-binding protein (RBP)
Class: transport protein
Keywords: RBP, retinol, TRANSPORT PROTEIN
Deposited on 2001-04-24, released 2002-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasma retinol-binding protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41263 (1-173)
      • initiating met (0)
    Domains in SCOPe 2.07: d1iiua_
  • Heterogens: CD, RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iiuA (A:)
mdcrvssfkvkenfdknrysgtwyamakkdpeglflqdnvvaqftvdengqmsatakgrv
rlfnnwdvcadmigsftdtedpakfkmkywgvasflqkgnddhwvvdtdydtyalhyscr
elnedgtcadsysfvfsrdpkglppeaqkivrqrqidlcldrkyrvivhngfcs