PDB entry 1icn

View 1icn on RCSB PDB site
Description: escherichia coli-derived rat intestinal fatty acid binding protein with bound myristate at 1.5 a resolution and i-fabparg106-->gln with bound oleate at 1.74 a resolution
Deposited on 1993-09-20, released 1994-01-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.74 Å
R-factor: 0.161
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1icn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icn_ (-)
  afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
  vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavqeisgneliqtytye
  gveakrifkke