PDB entry 1ib1

View 1ib1 on RCSB PDB site
Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
Class: signaling protein/transferase
Keywords: n-acetyl transferase, 14-3-3, signal transduction, protein-protein complex, phosphorylation, signaling protein/transferase complex
Deposited on 2001-03-26, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 zeta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ib1a_
  • Chain 'B':
    Compound: 14-3-3 zeta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ib1b_
  • Chain 'C':
    Compound: 14-3-3 zeta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ib1c_
  • Chain 'D':
    Compound: 14-3-3 zeta isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ib1d_
  • Chain 'E':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: AANAT OR SNAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29495
      • modified residue (29)
    Domains in SCOPe 2.06: d1ib1e_
  • Chain 'F':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: AANAT OR SNAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29495
      • modified residue (29)
    Domains in SCOPe 2.06: d1ib1f_
  • Chain 'G':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: AANAT OR SNAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29495
      • modified residue (29)
    Domains in SCOPe 2.06: d1ib1g_
  • Chain 'H':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: AANAT OR SNAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29495
      • modified residue (29)
    Domains in SCOPe 2.06: d1ib1h_
  • Heterogens: COT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ib1A (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1A (A:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ib1B (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1B (B:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ib1C (C:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1C (C:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ib1D (D:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1D (D:)
    dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
    vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
    kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ib1E (E:)
    stpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsg
    ncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsahl
    halavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcai
    vvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1E (E:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ib1F (F:)
    stpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsg
    ncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsahl
    halavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcai
    vvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1F (F:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ib1G (G:)
    stpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsg
    ncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsahl
    halavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcai
    vvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1G (G:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ib1H (H:)
    stpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsg
    ncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsahl
    halavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcai
    vvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ib1H (H:)
    sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
    pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
    vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr