PDB entry 1i4m

View 1i4m on RCSB PDB site
Description: Crystal structure of the human prion protein reveals a mechanism for oligomerization
Class: membrane protein
Keywords: domain-swapped dimer, membrane protein
Deposited on 2001-02-22, released 2002-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i4ma_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4mA (A:)
    gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
    cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayy