PDB entry 1i4m

View 1i4m on RCSB PDB site
Description: Crystal structure of the human prion protein reveals a mechanism for oligomerization
Deposited on 2001-02-22, released 2002-02-27
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i4ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4mA (A:)
    gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
    cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayy