PDB entry 1i2g

View 1i2g on RCSB PDB site
Description: Ribonuclease T1 V16T mutant
Class: hydrolase
Keywords: ribonuclease T1, hydrophobic core packing, HYDROLASE
Deposited on 2001-02-09, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: guanyl-specific ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • engineered (15)
    • engineered (24)
  Domains in SCOPe 2.07: d1i2ga_
• Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i2gA (A:)
  acdytcgsncysssdtstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect