PDB entry 1i0u

View 1i0u on RCSB PDB site
Description: solution structure and backbone dynamics of a concatemer of egf-homology modules of the human low density lipoprotein receptor
Class: lipid binding protein
Keywords: anti-parallel beta strands, calcium binding sites, LIPID BINDING PROTEIN
Deposited on 2001-01-29, released 2001-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1i0ua1, d1i0ua2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i0uA (A:)
    gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
    gykcqceegfqldphtkackav