PDB entry 1hzh

View 1hzh on RCSB PDB site
Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
Class: immune system
Keywords: immunoglobulin, antibody, b12, IMMUNE SYSTEM
Deposited on 2001-01-24, released 2001-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HZH (0-123)
    • Uniprot P0DOX5 (124-456)
      • conflict (224)
    Domains in SCOPe 2.07: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhh4
  • Chain 'K':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HZH (0-123)
    • Uniprot P0DOX5 (124-End)
      • conflict (224)
    Domains in SCOPe 2.07: d1hzhk1, d1hzhk2, d1hzhk3, d1hzhk4
  • Chain 'L':
    Compound: IMMUNOGLOBULIN LIGHT CHAIN,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HZH (0-106)
    • Uniprot Q8TCD0 (107-214)
      • conflict (202)
    Domains in SCOPe 2.07: d1hzhl1, d1hzhl2
  • Chain 'M':
    Compound: IMMUNOGLOBULIN LIGHT CHAIN,Uncharacterized protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HZH (0-106)
    • Uniprot Q8TCD0 (107-214)
      • conflict (202)
    Domains in SCOPe 2.07: d1hzhm1, d1hzhm2
  • Heterogens: NAG, BMA, MAN, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkcppcpapellggpsv
    flfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty
    rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltk
    nqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqg
    nvfscsvmhealhnhytqkslsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhL (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhM (M:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec