Lineage for d1hzhh4 (1hzh H:360-478)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748723Domain d1hzhh4: 1hzh H:360-478 [61440]
    Other proteins in same PDB: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhk1, d1hzhk2, d1hzhk3, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhh4

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d1hzhh4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhh4 b.1.1.2 (H:360-478) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk

SCOPe Domain Coordinates for d1hzhh4:

Click to download the PDB-style file with coordinates for d1hzhh4.
(The format of our PDB-style files is described here.)

Timeline for d1hzhh4: