PDB entry 1hz8

View 1hz8 on RCSB PDB site
Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor
Deposited on 2001-01-23, released 2001-08-15
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1hz8a1, d1hz8a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hz8A (A:)
  gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
  gykcqceegfqldphtkackav