PDB entry 1hw2

View 1hw2 on RCSB PDB site
Description: fadr-DNA complex: transcriptional control of fatty acid metabolism in echerichia coli
Class: transcription/DNA
Keywords: helix-turn-helix, helix bundle, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-01-09, released 2001-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.235
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid metabolism regulator protein
    Species: Escherichia coli [TaxId:562]
    Gene: FADR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hw2a1, d1hw2a2
  • Chain 'B':
    Compound: fatty acid metabolism regulator protein
    Species: Escherichia coli [TaxId:562]
    Gene: FADR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hw2b1, d1hw2b2
  • Chain 'D':
    Compound: 5'-d(*cp*gp*ap*tp*cp*tp*gp*gp*tp*cp*cp*gp*ap*cp*cp*ap*gp*ap*tp*gp*cp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*g*cp*ap*tp*cp*tp*gp*gp*tp*cp*gp*gp*ap*cp*cp*ap*gp*ap*tp*cp*gp*a)-3'
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hw2A (A:)
    mvikaqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgw
    ltiqhgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqh
    pdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyf
    anpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdlaiqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hw2A (A:)
    spagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqhg
    kptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqe
    vlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpear
    slalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hw2B (B:)
    mvikaqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgw
    ltiqhgkptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqh
    pdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyf
    anpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdlaiqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hw2B (B:)
    spagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqhg
    kptkvnnfwetsglniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqe
    vlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpear
    slalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.