SCOPe 2.08: Domain d1hw2a1: 1hw2 A:7-78

Lineage for d1hw2a1 (1hw2 A:7-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)

6. Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)

7. Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)

8. Domain d1hw2a1: 1hw2 A:7-78 [16114]
   Other proteins in same PDB: d1hw2a2, d1hw2b2
   protein/DNA complex; complexed with mg

Details for d1hw2a1

PDB Entry: 1hw2, 3.25 Å

PDB Description: fadr-dna complex: transcriptional control of fatty acid metabolism in echerichia coli

PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1hw2a1:

Sequence; same for both SEQRES and ATOM records:

>d1hw2a1 a.4.5.6 (A:7-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]}
spagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqhg
kptkvnnfwets

Timeline for d1hw2a1:

• d1hw2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1hw2a1 appears in SCOPe 2.07