Lineage for d1hw2a1 (1hw2 A:7-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693164Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)
  6. 2693165Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)
  7. 2693166Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)
  8. 2693171Domain d1hw2a1: 1hw2 A:7-78 [16114]
    Other proteins in same PDB: d1hw2a2, d1hw2b2
    protein/DNA complex; complexed with mg

Details for d1hw2a1

PDB Entry: 1hw2 (more details), 3.25 Å

PDB Description: fadr-dna complex: transcriptional control of fatty acid metabolism in echerichia coli
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1hw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw2a1 a.4.5.6 (A:7-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]}
spagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqhg
kptkvnnfwets

SCOPe Domain Coordinates for d1hw2a1:

Click to download the PDB-style file with coordinates for d1hw2a1.
(The format of our PDB-style files is described here.)

Timeline for d1hw2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw2a2