PDB entry 1htp

View 1htp on RCSB PDB site
Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex
Class: oxidoreductases(acting on ch-nh2 donor)
Keywords: oxidoreductases(acting on ch-nh2 donor)
Deposited on 1995-01-11, released 1995-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-protein
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1htpa_
  • Heterogens: OSS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1htpA (A:)
    snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
    svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
    tkfceeedaah