PDB entry 1htn

View 1htn on RCSB PDB site
Description: human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil
Class: lectin
Keywords: tetranectin, plasminogen binding, kringle 4, alpha-helical coiled coil, c-type lectin, carbohydrate recognition domain
Deposited on 1997-05-28, released 1997-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetranectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05452 (Start-181)
      • conflict (34)
    Domains in SCOPe 2.06: d1htna1, d1htna2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1htnA (A:)
    gepptqkpkkivnakkdvvntkmfeelksrldtlsqevallkeqqalqtvclkgtkvhmk
    cflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlglndmaa
    egtwvdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlpyicqfg
    iv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1htnA (A:)
    lksrldtlsqevallkeqqalqtvclkgtkvhmkcflaftqtktfheasedcisrggtls
    tpqtgsendalyeylrqsvgneaeiwlglndmaaegtwvdmtgariayknweteitaqpd
    ggktencavlsgaangkwfdkrcrdqlpyicqfgiv