PDB entry 1hre

View 1hre on RCSB PDB site
Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
Deposited on 1994-07-21, released 1994-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1hre__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hre_ (-)
    gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
    aeelyqk