PDB entry 1hrb

View 1hrb on RCSB PDB site
Description: atomic models for the polypeptide backbones of myohemerythrin and hemerythrin
Deposited on 1976-06-23, released 1978-09-28
The last revision prior to the SCOP 1.63 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 5.5 Å
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1hrb__
  • Chain 'B':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hrb_ (-)
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflnqev
lmeasqyqfydehkkehdgfinaldnwkgdvkwakawlvnhiktidfkykgki

  • Chain 'B':
    No sequence available.