PDB entry 1hp8

View 1hp8 on RCSB PDB site
Description: solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, minimized average structure
Class: cysteine motif
Keywords: hu-p8, leukemia, cysteine motif
Deposited on 1997-08-26, released 1998-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hu-p8
    Species: Homo sapiens [TaxId:9606]
    Gene: MTCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hp8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hp8A (A:)
mpqkdpcqkqaceiqkclqansymeskcqaviqelrkccaqypkgrsvvcsgfekeeeen
ltrksask