PDB entry 1hp2

View 1hp2 on RCSB PDB site
Description: solution structure of a toxin from the scorpion tityus serrulatus (tstx-k alpha) determined by nmr.
Class: toxin
Keywords: K+ channel, scorpion toxin, alpha-K toxin,
Deposited on 2000-12-12, released 2001-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tityustoxin k alpha
  Species: Tityus serrulatus [TaxId:6887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46114 (0-36)
  Domains in SCOPe 2.07: d1hp2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hp2A (A:)
  vfinakcrgspeclpkckeaigkaagkcmngkckcyp