PDB entry 1hmk

View 1hmk on RCSB PDB site
Description: recombinant goat alpha-lactalbumin
Deposited on 1998-11-26, released 1999-11-26
The last revision prior to the SCOP 1.61 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1hmka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hmkA (A:)
    meqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnki
    wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
    c