PDB entry 1hky

View 1hky on RCSB PDB site
Description: solution structure of a pan module from eimeria tenella
Class: adhesin
Keywords: adhesin, nmr, pan module, eimeria tenella
Deposited on 2002-10-03, released 2002-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: microneme protein 5 precursor
    Species: EIMERIA TENELLA [TaxId:5802]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKY (0-10)
    • Uniprot Q9U966 (11-85)
    Domains in SCOPe 2.07: d1hkya1, d1hkya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkyA (A:)
    dykddddkvkltcyqngvsftggkaiseakaassqacqelcekdakcrfftlasgkcslf
    addaalrptksdgavsgnkrcilled