PDB entry 1hjm

View 1hjm on RCSB PDB site
Description: human prion protein at ph 7.0
Class: prion protein
Keywords: prion protein, prion, brain, glycoprotein, gpi-anchor, repeat, signal
Deposited on 2003-02-27, released 2003-07-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hjma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjmA (A:)
    lggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
    kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqr