PDB entry 1hfs

View 1hfs on RCSB PDB site
Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the n-carboxy-alkyl inhibitor l-764,004
Deposited on 1997-02-13, released 1998-02-18
The last revision prior to the SCOP 1.63 freeze date was dated 1998-02-18, with a file datestamp of 1998-02-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1hfs__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hfs_ (-)
  gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
  vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
  glfhsantealmyplyhsltdltrfrlsqddingiqslyg