PDB entry 1haf

View 1haf on RCSB PDB site
Description: heregulin-alpha epidermal growth factor-like domain, nmr, minimized average structure
Deposited on 1995-11-30, released 1996-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1haf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1haf_ (-)
    shlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqekae
    ely