PDB entry 1hae

View 1hae on RCSB PDB site
Description: heregulin-alpha epidermal growth factor-like domain, nmr, 20 structures
Deposited on 1995-11-30, released 1996-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1hae__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hae_ (-)
    shlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqekae
    ely