PDB entry 1h9k

View 1h9k on RCSB PDB site
Description: two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with tungstate and phosphate bound
Deposited on 2001-03-13, released 2001-05-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-11, with a file datestamp of 2001-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h9kA (A:)
gshmkisarnvfkgtvsalkegavnaevdillgggdklaavvtlesarslqlaagkevva
vvkapwvllmtdssgyrlsarniltgtvktietgavnaevtlalqggteitsmvtkeava
elglkpgasasavikasnvilgvp