SCOP 1.57: Domain d1h9ka2: 1h9k A:74-141

Lineage for d1h9ka2 (1h9k A:74-141)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.6: MOP-like [50331] (3 families)

5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)

6. Protein Cytoplasmic molybdate-binding protein ModG [63776] (1 species)

7. Species Azotobacter vinelandii [TaxId:354] [63777] (3 PDB entries)

8. Domain d1h9ka2: 1h9k A:74-141 [60832]

Details for d1h9ka2

PDB Entry: 1h9k, 1.8 Å

PDB Description: two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with tungstate and phosphate bound

SCOP Domain Sequences for d1h9ka2:

Sequence; same for both SEQRES and ATOM records:

>d1h9ka2 b.40.6.2 (A:74-141) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii}
rlsarniltgtvktietgavnaevtlalqggteitsmvtkeavaelglkpgasasavika
snvilgvp

Timeline for d1h9ka2:

• d1h9ka2 is new in SCOP 1.57
  
• d1h9ka2 appears in SCOP 1.59
  
• d1h9ka2 appears in the current release, SCOPe 2.08