PDB entry 1h89

View 1h89 on RCSB PDB site
Description: crystal structure of ternary protein-DNA complex2
Class: transcription/DNA
Keywords: transcription/DNA, protein-DNA complex, transcription regulation, bzip, proto-oncogene, myb, c-myb, c/ebp, crystal structure
Deposited on 2001-01-30, released 2002-01-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.229
AEROSPACI score: -1.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caat/enhancer binding protein beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1h89a_
  • Chain 'B':
    Compound: caat/enhancer binding protein beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1h89b_
  • Chain 'C':
    Compound: Myb proto-oncogene protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GENP CAA26552
    Domains in SCOPe 2.04: d1h89c1, d1h89c2, d1h89c3
  • Chain 'D':
    Compound: DNA(5'-(*gp*ap*tp*gp*tp*gp*gp*cp*gp*cp*ap* ap*tp*cp*cp*tp*tp*ap*ap*cp*gp*gp*ap*cp*tp*g)-3')
  • Chain 'E':
    Compound: DNA(5'-(*cp*cp*ap*gp*tp*cp*cp*gp*tp*tp*ap* ap*gp*gp*ap*tp*tp*gp*cp*gp*cp*cp*ap*cp*ap*t)-3')
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h89A (A:)
    eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk
    qlpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h89B (B:)
    eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk
    qlpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h89C (C:)
    mghlgktrwtreedeklkklveqngtddwkvianylpnrtdvqcqhrwqkvlnpelikgp
    wtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevkktswteeedri
    iyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h89C (C:)
    qcqhrwqkvlnpelikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhn
    hlnpevkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.