PDB entry 1h4l

View 1h4l on RCSB PDB site
Description: structure and regulation of the cdk5-p25(nck5a) complex
Class: kinase/kinase activator
Keywords: kinase/kinase activator, complex(cyclins/cdk), cyclins, cyclin-dependent kinases, cdk5, p35, p25, transferase, ATP-binding, cell cycle, cell division, phosphorylation
Deposited on 2001-05-11, released 2002-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.236
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535
      • conflict (198)
    Domains in SCOPe 2.06: d1h4la_
  • Chain 'B':
    Compound: cell division protein kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00535
      • conflict (198)
    Domains in SCOPe 2.06: d1h4lb_
  • Chain 'D':
    Compound: cyclin-dependent kinase 5 activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h4ld_
  • Chain 'E':
    Compound: cyclin-dependent kinase 5 activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1h4le_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h4lA (A:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4lA (A:)
    qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
    lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
    qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
    cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
    nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h4lB (B:)
    mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
    knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
    nvlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklys
    tsidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
    mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h4lB (B:)
    qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
    lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
    qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
    cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
    nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4lD (D:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknes
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h4lE (E:)
    stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
    lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
    lmsskmlqinadphyftqvfsdlknes