PDB entry 1h0j
View 1h0j on RCSB PDB site
Description: structural basis of the membrane-induced cardiotoxin a3 oligomerization
Class: cardiotoxin
Keywords: cardiotoxin, sodium dodecyl sulfate, venom, cytotoxin
Deposited on
2002-06-20, released
2003-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cardiotoxin-3
Species: Naja atra [TaxId:8656]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1h0ja_ - Chain 'B':
Compound: cardiotoxin-3
Species: Naja atra [TaxId:8656]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1h0jb_ - Chain 'C':
Compound: cardiotoxin-3
Species: Naja atra [TaxId:8656]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1h0jc_ - Heterogens: SDS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1h0jA (A:)
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1h0jB (B:)
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1h0jC (C:)
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn