SCOPe 2.07: Structural Classification of Proteins

PDB entry 1gtz

View 1gtz on RCSB PDB site
Description: structure of streptomyces coelicolor type II dehydroquinase r23a mutant in complex with dehydroshikimate
Class: lyase
Keywords: lyase, type II dehydroquinase, shikimate pathway, dodecameric quaternary structure, tetrahedral symmetry aromatic amino acid biosynthesis
Deposited on 2002-01-22, released 2002-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtza_
Chain 'B':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzb_
Chain 'C':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzc_
Chain 'D':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzd_
Chain 'E':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtze_
Chain 'F':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzf_
Chain 'G':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzg_
Chain 'H':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzh_
Chain 'I':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzi_
Chain 'J':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzj_
Chain 'K':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzk_
Chain 'L':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- Uniprot P15474
  - engineered mutation (22)
Domains in SCOPe 2.07: d1gtzl_
Heterogens: TRS, DHK, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1gtzA (A:)
prslanapimilngpnlnllgqaqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalagagsara