PDB entry 1gps

View 1gps on RCSB PDB site
Description: solution structure of gamma 1-h and gamma 1-p thionins from barley and wheat endosperm determined by 1h-nmr: a structural motif common to toxic arthropod proteins
Deposited on 1992-07-29, released 1993-10-31
The last revision prior to the SCOP 1.63 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1gps__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gps_ (-)
    kicrrrsagfkgpcmsnkncaqvcqqegwgggncdgpfrrckcirqc